Glutathione Peroxidase 4 Antibody (Biotin)

Catalog number KB-21242-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-21242-01

Size / count 50 μL

Specifications

Catalog number: KB-21242-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Phospholipid hydroperoxide glutathione peroxidase, PHGPx, Glutathione peroxidase 4, GPx-4, GSHPx-4
Gene Name: GPX4
Gene ID: 2879
UniProt: P36969
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GPX4
Target: PP-4858
Partner Proteins: Phospholipid hydroperoxide glutathione peroxidase; PHGPx; Glutathione peroxidase 4; GPx-4; GSHPx-4
Clone: K24048_20E2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 92%, Pig - 94%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: SRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Glutathione Peroxidase 4
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Glutathione peroxidase 4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Glutathione Peroxidase 4 Antibody (Biotin)?

The catalog number for Glutathione Peroxidase 4 Antibody (Biotin) is KB-21242.

What sizes are available for Glutathione Peroxidase 4 Antibody (Biotin)?

Glutathione Peroxidase 4 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Glutathione Peroxidase 4 Antibody (Biotin) come in?

Glutathione Peroxidase 4 Antibody (Biotin) is available in 3 different pack sizes.

Is Glutathione Peroxidase 4 Antibody (Biotin) in stock?

Glutathione Peroxidase 4 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

All Products