Glutathione Peroxidase 4 Antibody

Catalog number KC-21242-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-21242-01

Size / count 50 μL

Specifications

Catalog number: KC-21242-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Phospholipid hydroperoxide glutathione peroxidase, PHGPx, Glutathione peroxidase 4, GPx-4, GSHPx-4
Gene Name: GPX4
Gene ID: 2879
UniProt: P36969
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GPX4
Target: PP-4858
Partner Proteins: Phospholipid hydroperoxide glutathione peroxidase; PHGPx; Glutathione peroxidase 4; GPx-4; GSHPx-4
Clone: K24048_20E2
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 92%, Pig - 94%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: SRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Glutathione Peroxidase 4
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Glutathione peroxidase 4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Glutathione Peroxidase 4 Antibody?

The catalog number for Glutathione Peroxidase 4 Antibody is KC-21242.

What sizes are available for Glutathione Peroxidase 4 Antibody?

Glutathione Peroxidase 4 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Glutathione Peroxidase 4 Antibody come in?

Glutathione Peroxidase 4 Antibody is available in 3 different pack sizes.

Is Glutathione Peroxidase 4 Antibody in stock?

Glutathione Peroxidase 4 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

All Products