Recombinant CA8 Antibody

Catalog number RN-14538-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14538-01

Size / count 50 μL

Specifications

Catalog number: RN-14538-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carbonic anhydrase-related protein, CARP, Carbonic anhydrase VIII, CA-VIII
Gene Name: CA8
Gene ID: 767
UniProt: P35219
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CA8
Target: PP-11253
Partner Proteins: Carbonic anhydrase-related protein; CARP; Carbonic anhydrase VIII; CA-VIII
Clone: K40108_20H12
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CALS
Target Alternative Name: CA8
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Carbonic anhydrase 8
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CA8 Antibody?

The catalog number for Recombinant CA8 Antibody is RN-14538.

What sizes are available for Recombinant CA8 Antibody?

Recombinant CA8 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CA8 Antibody come in?

Recombinant CA8 Antibody is available in 3 different pack sizes.

Is Recombinant CA8 Antibody in stock?

Recombinant CA8 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.