CD70 Antibody (Biotin)

Catalog number KB-7324-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7324-01

Size / count 50 μL

Specifications

Catalog number: KB-7324-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CD70 antigen, CD27 ligand, CD27-L, Tumor necrosis factor ligand superfamily member 7, CD antigen CD70
Gene Name: CD70
Gene ID: 970
UniProt: P32970
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD70
Target Antigen: CD70
Target: PP-3801
Partner Proteins: CD70 antigen; CD27 ligand; CD27-L; Tumor necrosis factor ligand superfamily member 7; CD antigen CD70
Clone: K52066_4F1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 66%, Pig - 71%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: ESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQW
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 66%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CD27L; CD27LG; TNFSF7
Target Alternative Name: CD70
Panel Description: Cytokines, CD Antigen
Host or Source: Mouse
Protein Name: CD70 molecule
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CD70 Antibody (Biotin)?

The catalog number for CD70 Antibody (Biotin) is KB-7324.

What sizes are available for CD70 Antibody (Biotin)?

CD70 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD70 Antibody (Biotin) come in?

CD70 Antibody (Biotin) is available in 3 different pack sizes.

Is CD70 Antibody (Biotin) in stock?

CD70 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

All Products