Recombinant ALDH1B1 Antibody

Catalog number RN-14518-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14518-01

Size / count 50 μL

Specifications

Catalog number: RN-14518-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Aldehyde dehydrogenase X, mitochondrial, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1
Gene Name: ALDH1B1
Gene ID: 219
UniProt: P30837
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ALDH1B1
Target: PP-5629
Partner Proteins: Aldehyde dehydrogenase X; mitochondrial; Aldehyde dehydrogenase 5; Aldehyde dehydrogenase family 1 member B1
Clone: K29104_20A6
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 96%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: TGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ALDH5; ALDHX
Target Alternative Name: ALDH1B1
Host or Source: Mouse
Protein Name: Aldehyde dehydrogenase 1 family member B1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ALDH1B1 Antibody?

The catalog number for Recombinant ALDH1B1 Antibody is RN-14518.

What sizes are available for Recombinant ALDH1B1 Antibody?

Recombinant ALDH1B1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ALDH1B1 Antibody come in?

Recombinant ALDH1B1 Antibody is available in 3 different pack sizes.

Is Recombinant ALDH1B1 Antibody in stock?

Recombinant ALDH1B1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

All Products