Product details

Caspase-1 Antibody

Catalog number KC-38360-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-38360-01

Size / count 50 μL

Specifications

Catalog number: KC-38360-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-1, CASP-1, Interleukin-1 beta convertase, IL-1BC, Interleukin-1 beta-converting enzyme, ICE, IL-1 beta-converting enzyme, p45) [Cleaved into: Caspase-1 subunit p20, Caspase-1 subunit p10]
Gene Name: CASP1
Gene ID: 834
UniProt: P29466
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP1
Target: PP-1837
Partner Proteins: Caspase-1; CASP-1; Interleukin-1 beta convertase; IL-1BC; Interleukin-1 beta-converting enzyme; ICE; IL-1 beta-converting enzyme; p45) [Cleaved into: Caspase-1 subunit p20; Caspase-1 subunit p10]
Clone: K9N054_6D5
Conjugation: Unconjugated
Applications: Top_IHC&WB
Validation: Top_IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Rat - 63%, Pig - 73%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: IL1BC; IL1BCE
Target Alternative Name: Caspase-1
Host or Source: Mouse
Protein Name: Caspase 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Caspase-1 Antibody?

The catalog number for Caspase-1 Antibody is KC-38360.

What sizes are available for Caspase-1 Antibody?

Caspase-1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-1 Antibody come in?

Caspase-1 Antibody is available in 3 different pack sizes.

Is Caspase-1 Antibody in stock?

Caspase-1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

All Products