CD38 Antibody (Biotin)

Catalog number KB-3656-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3656-01

Size / count 50 μL

Specifications

Catalog number: KB-3656-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1, 2'-phospho-ADP-ribosyl cyclase, 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase, 2'-phospho-cyclic-ADP-ribose transferase, ADP-ribosyl cyclase 1, ADPRC 1, Cyclic ADP-ribose hydrolase 1, cADPR hydrolase 1, T10, CD antigen CD38
Gene Name: CD38
Gene ID: 952
UniProt: P28907
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD38
Target Antigen: CD38
Target: PP-565
Partner Proteins: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; 2'-phospho-ADP-ribosyl cyclase; 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-cyclic-ADP-ribose transferase; ADP-ribosyl cyclase 1; ADPRC 1; Cyclic ADP-ribose hydrolase 1; cADPR hydrolase 1; T10; CD antigen CD38
Clone: K94011_11F5
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 58%, Pig - 56%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: SRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 53%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CD38
Panel Description: IHC Pathology, CD Antigen, Ferroptosis
Host or Source: Mouse
Protein Name: CD38 molecule
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CD38 Antibody (Biotin)?

The catalog number for CD38 Antibody (Biotin) is KB-3656.

What sizes are available for CD38 Antibody (Biotin)?

CD38 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD38 Antibody (Biotin) come in?

CD38 Antibody (Biotin) is available in 3 different pack sizes.

Is CD38 Antibody (Biotin) in stock?

CD38 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

All Products