Product details

Calreticulin Antibody

Catalog number KC-9751-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-9751-01

Size / count 50 μL

Specifications

Catalog number: KC-9751-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Calreticulin, CRP55, Calregulin, Endoplasmic reticulum resident protein 60, ERp60, HACBP, grp60
Gene Name: CALR
Gene ID: 811
UniProt: P27797
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CALR
Target: PP-231
Partner Proteins: Calreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP; grp60
Clone: K24014_6F4
Conjugation: Unconjugated
Applications: Top_IHC&ELISA
Validation: Top_IHC&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: LVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CRTC
Target Alternative Name: Calreticulin
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Calreticulin
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Calreticulin Antibody?

The catalog number for Calreticulin Antibody is KC-9751.

What sizes are available for Calreticulin Antibody?

Calreticulin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Calreticulin Antibody come in?

Calreticulin Antibody is available in 3 different pack sizes.

Is Calreticulin Antibody in stock?

Calreticulin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

All Products