Calreticulin Antibody

Catalog number KC-9777-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-9777-01

Size / count 50 μL

Specifications

Catalog number: KC-9777-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Calreticulin, CRP55, Calregulin, Endoplasmic reticulum resident protein 60, ERp60, HACBP, grp60
Gene Name: CALR
Gene ID: 811
UniProt: P27797
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CALR
Target: PP-231
Partner Proteins: Calreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP; grp60
Clone: K24014_18C3
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: LVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CRTC
Target Alternative Name: Calreticulin
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Calreticulin
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Calreticulin Antibody?

The catalog number for Calreticulin Antibody is KC-9777.

What sizes are available for Calreticulin Antibody?

Calreticulin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Calreticulin Antibody come in?

Calreticulin Antibody is available in 3 different pack sizes.

Is Calreticulin Antibody in stock?

Calreticulin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

All Products