APEX1 Antibody (Biotin)

Catalog number KB-8083-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8083-01

Size / count 50 μL

Specifications

Catalog number: KB-8083-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: DNA- (apurinic or apyrimidinic site) endonuclease, APEX nuclease, APEN, Apurinic-apyrimidinic endonuclease 1, AP endonuclease 1, APE-1, REF-1, Redox factor-1) [Cleaved into: DNA- (apurinic or apyrimidinic site) endonuclease, mitochondrial]
Gene Name: APEX1
Gene ID: 328
UniProt: P27695
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human APEX1
Target: PP-230
Partner Proteins: DNA- (apurinic or apyrimidinic site) endonuclease; APEX nuclease; APEN; Apurinic-apyrimidinic endonuclease 1; AP endonuclease 1; APE-1; REF-1; Redox factor-1) [Cleaved into: DNA- (apurinic or apyrimidinic site) endonuclease; mitochondrial]
Clone: K29036_13F4
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 84%, Pig - 88%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: AEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: APE; APE1; APEX; APX; HAP1; REF1
Target Alternative Name: APEX1
Host or Source: Mouse
Protein Name: Apurinic/apyrimidinic endodeoxyribonuclease 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for APEX1 Antibody (Biotin)?

The catalog number for APEX1 Antibody (Biotin) is KB-8083.

What sizes are available for APEX1 Antibody (Biotin)?

APEX1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does APEX1 Antibody (Biotin) come in?

APEX1 Antibody (Biotin) is available in 3 different pack sizes.

Is APEX1 Antibody (Biotin) in stock?

APEX1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

All Products