CBLIF Antibody (Biotin)

Catalog number KB-22809-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-22809-01

Size / count 50 μL

Specifications

Catalog number: KB-22809-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cobalamin binding intrinsic factor, Gastric intrinsic factor, Intrinsic factor, IF, INF
Gene Name: CBLIF
Gene ID: 2694
UniProt: P27352
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CBLIF
Target: P02186PAD
Partner Proteins: Cobalamin binding intrinsic factor; Gastric intrinsic factor; Intrinsic factor; IF; INF
Clone: K24050_9A11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 83%
Purity: ≥85%
Cores: MNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 83%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: GIF; IFMH
Target Alternative Name: CBLIF
Panel Description: Autoimmune Disease
Host or Source: Mouse
Protein Name: Cobalamin binding intrinsic factor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for CBLIF Antibody (Biotin)?

The catalog number for CBLIF Antibody (Biotin) is KB-22809.

What sizes are available for CBLIF Antibody (Biotin)?

CBLIF Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CBLIF Antibody (Biotin) come in?

CBLIF Antibody (Biotin) is available in 3 different pack sizes.

Is CBLIF Antibody (Biotin) in stock?

CBLIF Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

All Products