CBLIF Antibody (Biotin)

Catalog number KB-22745-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-22745-01

Size / count 50 μL

Specifications

Catalog number: KB-22745-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cobalamin binding intrinsic factor, Gastric intrinsic factor, Intrinsic factor, IF, INF
Gene Name: CBLIF
Gene ID: 2694
UniProt: P27352
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CBLIF
Target: P02186PAD
Partner Proteins: Cobalamin binding intrinsic factor; Gastric intrinsic factor; Intrinsic factor; IF; INF
Clone: K24050_12F7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 83%
Purity: ≥85%
Cores: MNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 83%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: GIF; IFMH
Target Alternative Name: CBLIF
Panel Description: Autoimmune Disease
Host or Source: Mouse
Protein Name: Cobalamin binding intrinsic factor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CBLIF Antibody (Biotin)?

The catalog number for CBLIF Antibody (Biotin) is KB-22745.

What sizes are available for CBLIF Antibody (Biotin)?

CBLIF Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CBLIF Antibody (Biotin) come in?

CBLIF Antibody (Biotin) is available in 3 different pack sizes.

Is CBLIF Antibody (Biotin) in stock?

CBLIF Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

All Products