Cathepsin S Antibody

Catalog number KC-14100-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-14100-01

Size / count 50 μL

Specifications

Catalog number: KC-14100-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cathepsin S
Gene Name: CTSS
Gene ID: 1520
UniProt: P25774
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CTSS
Target: PP-1683
Partner Proteins: Cathepsin S
Clone: K9N001_3E11
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 81%, Pig - 84%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Cathepsin S
Host or Source: Mouse
Protein Name: Cathepsin S
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Cathepsin S Antibody?

The catalog number for Cathepsin S Antibody is KC-14100.

What sizes are available for Cathepsin S Antibody?

Cathepsin S Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Cathepsin S Antibody come in?

Cathepsin S Antibody is available in 3 different pack sizes.

Is Cathepsin S Antibody in stock?

Cathepsin S Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.