FAS Antibody (Biotin)

Catalog number KB-8345-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8345-01

Size / count 50 μL

Specifications

Catalog number: KB-8345-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor receptor superfamily member 6, Apo-1 antigen, Apoptosis-mediating surface antigen FAS, FASLG receptor, CD antigen CD95
Gene Name: FAS
Gene ID: 355
UniProt: P25445
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FAS
Target Antigen: CD95
Target: PP-767
Partner Proteins: Tumor necrosis factor receptor superfamily member 6; Apo-1 antigen; Apoptosis-mediating surface antigen FAS; FASLG receptor; CD antigen CD95
Clone: K40069_10A6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 47%, Rat - 45%, Pig - 58%, Cynomolgus monkey - 86%
Purity: ≥85%
Cores: KHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 47%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: APT1; FAS1; TNFRSF6
Target Alternative Name: FAS
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Fas cell surface death receptor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for FAS Antibody (Biotin)?

The catalog number for FAS Antibody (Biotin) is KB-8345.

What sizes are available for FAS Antibody (Biotin)?

FAS Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does FAS Antibody (Biotin) come in?

FAS Antibody (Biotin) is available in 3 different pack sizes.

Is FAS Antibody (Biotin) in stock?

FAS Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.