RNA Polymerase II Subunit B1 Antibody (Biotin)

Catalog number KB-1061-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1061-01

Size / count 50 μL

Specifications

Catalog number: KB-1061-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: DNA-directed RNA polymerase II subunit RPB1, RNA polymerase II subunit B1, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase III largest subunit, RNA-directed RNA polymerase II subunit RPB1
Gene Name: POLR2A
Gene ID: 5430
UniProt: P24928
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human POLR2A
Target: PP-764
Partner Proteins: DNA-directed RNA polymerase II subunit RPB1; RNA polymerase II subunit B1; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase III largest subunit; RNA-directed RNA polymerase II subunit RPB1
Clone: K16265_20D1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: IAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: POLR2
Target Alternative Name: RNA Polymerase II Subunit B1
Host or Source: Mouse
Protein Name: RNA polymerase II subunit A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RNA Polymerase II Subunit B1 Antibody (Biotin)?

The catalog number for RNA Polymerase II Subunit B1 Antibody (Biotin) is KB-1061.

What sizes are available for RNA Polymerase II Subunit B1 Antibody (Biotin)?

RNA Polymerase II Subunit B1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RNA Polymerase II Subunit B1 Antibody (Biotin) come in?

RNA Polymerase II Subunit B1 Antibody (Biotin) is available in 3 different pack sizes.

Is RNA Polymerase II Subunit B1 Antibody (Biotin) in stock?

RNA Polymerase II Subunit B1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.