ACP1 Antibody (Biotin)

Catalog number KB-8135-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8135-01

Size / count 50 μL

Specifications

Catalog number: KB-8135-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Low molecular weight phosphotyrosine protein phosphatase, LMW-PTP, LMW-PTPase, Adipocyte acid phosphatase, Low molecular weight cytosolic acid phosphatase, Red cell acid phosphatase 1
Gene Name: ACP1
Gene ID: 52
UniProt: P24666
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ACP1
Target: PP-1682
Partner Proteins: Low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; Adipocyte acid phosphatase; Low molecular weight cytosolic acid phosphatase; Red cell acid phosphatase 1
Clone: K52067_8G2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Rat - 89%, Pig - 91%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIED
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 88%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ACP1
Host or Source: Mouse
Protein Name: Acid phosphatase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for ACP1 Antibody (Biotin)?

The catalog number for ACP1 Antibody (Biotin) is KB-8135.

What sizes are available for ACP1 Antibody (Biotin)?

ACP1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ACP1 Antibody (Biotin) come in?

ACP1 Antibody (Biotin) is available in 3 different pack sizes.

Is ACP1 Antibody (Biotin) in stock?

ACP1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.