IL32 Antibody (Biotin)

Catalog number KB-3349-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3349-01

Size / count 50 μL

Specifications

Catalog number: KB-3349-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-32, IL-32, Natural killer cells protein 4, Tumor necrosis factor alpha-inducing factor
Gene Name: IL32
Gene ID: 9235
UniProt: P24001
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL32
Target: PP-1680
Partner Proteins: Interleukin-32; IL-32; Natural killer cells protein 4; Tumor necrosis factor alpha-inducing factor
Clone: K52005_3C12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Purity: ≥85%
Cores: TVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: NK4; TAIF
Target Alternative Name: IL32
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Interleukin 32
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for IL32 Antibody (Biotin)?

The catalog number for IL32 Antibody (Biotin) is KB-3349.

What sizes are available for IL32 Antibody (Biotin)?

IL32 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL32 Antibody (Biotin) come in?

IL32 Antibody (Biotin) is available in 3 different pack sizes.

Is IL32 Antibody (Biotin) in stock?

IL32 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.