ATP2B4 Antibody (Biotin)

Catalog number KB-7866-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7866-01

Size / count 50 μL

Specifications

Catalog number: KB-7866-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Plasma membrane calcium-transporting ATPase 4, PMCA4, Matrix-remodeling-associated protein 1, Plasma membrane calcium ATPase isoform 4, Plasma membrane calcium pump isoform 4
Gene Name: ATP2B4
Gene ID: 493
UniProt: P23634
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ATP2B4
Target: PP-762
Partner Proteins: Plasma membrane calcium-transporting ATPase 4; PMCA4; Matrix-remodeling-associated protein 1; Plasma membrane calcium ATPase isoform 4; Plasma membrane calcium pump isoform 4
Clone: K52069_19A7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 89%, Rat - 91%, Pig - 90%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: QCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKKGKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 89%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ATP2B2; MXRA1
Target Alternative Name: ATP2B4
Host or Source: Mouse
Protein Name: ATPase plasma membrane Ca2+ transporting 4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for ATP2B4 Antibody (Biotin)?

The catalog number for ATP2B4 Antibody (Biotin) is KB-7866.

What sizes are available for ATP2B4 Antibody (Biotin)?

ATP2B4 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ATP2B4 Antibody (Biotin) come in?

ATP2B4 Antibody (Biotin) is available in 3 different pack sizes.

Is ATP2B4 Antibody (Biotin) in stock?

ATP2B4 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.