NPPC Antibody (Biotin)

Catalog number KB-3256-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3256-01

Size / count 50 μL

Specifications

Catalog number: KB-3256-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: C-type natriuretic peptide [Cleaved into: CNP-22, CNP-29, CNP-53]
Gene Name: NPPC
Gene ID: 4880
UniProt: P23582
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NPPC
Target: PP-3255
Partner Proteins: C-type natriuretic peptide [Cleaved into: CNP-22; CNP-29; CNP-53]
Clone: K06361_5C5
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 94%, Pig - 95%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: VPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CNP2
Target Alternative Name: NPPC
Host or Source: Mouse
Protein Name: Natriuretic peptide C
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for NPPC Antibody (Biotin)?

The catalog number for NPPC Antibody (Biotin) is KB-3256.

What sizes are available for NPPC Antibody (Biotin)?

NPPC Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does NPPC Antibody (Biotin) come in?

NPPC Antibody (Biotin) is available in 3 different pack sizes.

Is NPPC Antibody (Biotin) in stock?

NPPC Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.