Integrin alpha-6 Antibody — image 1 of 2

Product details

Integrin alpha-6 Antibody

Catalog number KC-7679-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7679-01

Size / count 50 μL

Specifications

Catalog number: KC-7679-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Integrin alpha-6, CD49 antigen-like family member F, VLA-6, CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain, Integrin alpha-6 light chain, Processed integrin alpha-6, Alpha6p]
Gene Name: ITGA6
Gene ID: 3655
UniProt: P23229
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ITGA6
Target Antigen: CD49f
Target: PP-225
Partner Proteins: Integrin alpha-6; CD49 antigen-like family member F; VLA-6; CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain; Integrin alpha-6 light chain; Processed integrin alpha-6; Alpha6p]
Clone: K40064_4F7
Conjugation: Unconjugated
Applications: Top_WB&ELISA
Validation: Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 47%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: ITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Not recombinant
WB Dilution: 1:4000
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Integrin alpha-6
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Integrin subunit alpha 6
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Integrin alpha-6 Antibody?

The catalog number for Integrin alpha-6 Antibody is KC-7679.

What sizes are available for Integrin alpha-6 Antibody?

Integrin alpha-6 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Integrin alpha-6 Antibody come in?

Integrin alpha-6 Antibody is available in 3 different pack sizes.

Is Integrin alpha-6 Antibody in stock?

Integrin alpha-6 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

All Products