Integrin alpha-6 Antibody (Biotin)

Catalog number KB-7684-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7684-01

Size / count 50 μL

Specifications

Catalog number: KB-7684-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Integrin alpha-6, CD49 antigen-like family member F, VLA-6, CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain, Integrin alpha-6 light chain, Processed integrin alpha-6, Alpha6p]
Gene Name: ITGA6
Gene ID: 3655
UniProt: P23229
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ITGA6
Target Antigen: CD49f
Target: PP-225
Partner Proteins: Integrin alpha-6; CD49 antigen-like family member F; VLA-6; CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain; Integrin alpha-6 light chain; Processed integrin alpha-6; Alpha6p]
Clone: K40064_19C11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 47%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: ITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Integrin alpha-6
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Integrin subunit alpha 6
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Integrin alpha-6 Antibody (Biotin)?

The catalog number for Integrin alpha-6 Antibody (Biotin) is KB-7684.

What sizes are available for Integrin alpha-6 Antibody (Biotin)?

Integrin alpha-6 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Integrin alpha-6 Antibody (Biotin) come in?

Integrin alpha-6 Antibody (Biotin) is available in 3 different pack sizes.

Is Integrin alpha-6 Antibody (Biotin) in stock?

Integrin alpha-6 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.