Liver Carboxylesterase 1 Antibody (Biotin)

Catalog number KB-8241-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8241-01

Size / count 50 μL

Specifications

Catalog number: KB-8241-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Liver carboxylesterase 1, Acyl-coenzyme A:cholesterol acyltransferase, ACAT, Brain carboxylesterase hBr1, Carboxylesterase 1, CE-1, hCE-1, Cholesteryl ester hydrolase, CEH, Cocaine carboxylesterase, Egasyn, HMSE, Methylumbelliferyl-acetate deacetylase 1, Monocyte/macrophage serine esterase, Retinyl ester hydrolase, REH, Serine esterase 1, Triacylglycerol hydrolase, TGH
Gene Name: CES1
Gene ID: 1066
UniProt: P23141
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CES1
Target: PP-1675
Partner Proteins: Liver carboxylesterase 1; Acyl-coenzyme A:cholesterol acyltransferase; ACAT; Brain carboxylesterase hBr1; Carboxylesterase 1; CE-1; hCE-1; Cholesteryl ester hydrolase; CEH; Cocaine carboxylesterase; Egasyn; HMSE; Methylumbelliferyl-acetate deacetylase 1; Monocyte/macrophage serine esterase; Retinyl ester hydrolase; REH; Serine esterase 1; Triacylglycerol hydrolase; TGH
Clone: K1E067_13G12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 77%, Rat - 80%, Pig - 77%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: GAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 77%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CES2; SES1
Target Alternative Name: Liver Carboxylesterase 1
Host or Source: Mouse
Protein Name: Carboxylesterase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Liver Carboxylesterase 1 Antibody (Biotin)?

The catalog number for Liver Carboxylesterase 1 Antibody (Biotin) is KB-8241.

What sizes are available for Liver Carboxylesterase 1 Antibody (Biotin)?

Liver Carboxylesterase 1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Liver Carboxylesterase 1 Antibody (Biotin) come in?

Liver Carboxylesterase 1 Antibody (Biotin) is available in 3 different pack sizes.

Is Liver Carboxylesterase 1 Antibody (Biotin) in stock?

Liver Carboxylesterase 1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.