CA4 Antibody (Biotin)

Catalog number KB-8179-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8179-01

Size / count 50 μL

Specifications

Catalog number: KB-8179-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carbonic anhydrase 4, Carbonate dehydratase IV, Carbonic anhydrase IV, CA-IV
Gene Name: CA4
Gene ID: 762
UniProt: P22748
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CA4
Target: P06395QA
Partner Proteins: Carbonic anhydrase 4; Carbonate dehydratase IV; Carbonic anhydrase IV; CA-IV
Clone: K40078_7A4
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Purity: ≥85%
Cores: SHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CA4
Host or Source: Mouse
Protein Name: Carbonic anhydrase 4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CA4 Antibody (Biotin)?

The catalog number for CA4 Antibody (Biotin) is KB-8179.

What sizes are available for CA4 Antibody (Biotin)?

CA4 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CA4 Antibody (Biotin) come in?

CA4 Antibody (Biotin) is available in 3 different pack sizes.

Is CA4 Antibody (Biotin) in stock?

CA4 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

All Products