CA4 Antibody (Biotin)

Catalog number KB-8178-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8178-01

Size / count 50 μL

Specifications

Catalog number: KB-8178-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carbonic anhydrase 4, Carbonate dehydratase IV, Carbonic anhydrase IV, CA-IV
Gene Name: CA4
Gene ID: 762
UniProt: P22748
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CA4
Target: P06395QA
Partner Proteins: Carbonic anhydrase 4; Carbonate dehydratase IV; Carbonic anhydrase IV; CA-IV
Clone: K40078_17C12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Purity: ≥85%
Cores: SHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CA4
Host or Source: Mouse
Protein Name: Carbonic anhydrase 4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CA4 Antibody (Biotin)?

The catalog number for CA4 Antibody (Biotin) is KB-8178.

What sizes are available for CA4 Antibody (Biotin)?

CA4 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CA4 Antibody (Biotin) come in?

CA4 Antibody (Biotin) is available in 3 different pack sizes.

Is CA4 Antibody (Biotin) in stock?

CA4 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.