GAL Antibody (Biotin)

Catalog number KB-1706-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1706-01

Size / count 50 μL

Specifications

Catalog number: KB-1706-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Galanin peptides [Cleaved into: Galanin, Galanin message-associated peptide, GMAP]
Gene Name: GAL
Gene ID: 51083
UniProt: P22466
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GAL
Target: PP-223
Partner Proteins: Galanin peptides [Cleaved into: Galanin; Galanin message-associated peptide; GMAP]
Clone: K24019_11A9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Rat - 69%, Pig - 72%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: YLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 72%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: GAL1; GALN; GLNN
Target Alternative Name: GAL
Host or Source: Mouse
Protein Name: Galanin and GMAP prepropeptide
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for GAL Antibody (Biotin)?

The catalog number for GAL Antibody (Biotin) is KB-1706.

What sizes are available for GAL Antibody (Biotin)?

GAL Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does GAL Antibody (Biotin) come in?

GAL Antibody (Biotin) is available in 3 different pack sizes.

Is GAL Antibody (Biotin) in stock?

GAL Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

All Products