AREG Antibody (Biotin)

Catalog number KB-3685-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3685-01

Size / count 50 μL

Specifications

Catalog number: KB-3685-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Amphiregulin, AR, Colorectum cell-derived growth factor, CRDGF
Gene Name: AREG
Gene ID: 374
UniProt: P15514
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human AREG
Target: PP-1263
Partner Proteins: Amphiregulin; AR; Colorectum cell-derived growth factor; CRDGF
Clone: K40022_14A10
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 77%, Rat - 75%, Pig - 90%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: PQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 77%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: AREGB; SDGF
Target Alternative Name: AREG
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Amphiregulin
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for AREG Antibody (Biotin)?

The catalog number for AREG Antibody (Biotin) is KB-3685.

What sizes are available for AREG Antibody (Biotin)?

AREG Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does AREG Antibody (Biotin) come in?

AREG Antibody (Biotin) is available in 3 different pack sizes.

Is AREG Antibody (Biotin) in stock?

AREG Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.