Interferon gamma Receptor 1 Antibody

Catalog number KC-8862-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-8862-01

Size / count 50 μL

Specifications

Catalog number: KC-8862-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon gamma receptor 1, IFN-gamma receptor 1, IFN-gamma-R1, CDw119, Interferon gamma receptor alpha-chain, IFN-gamma-R-alpha, CD antigen CD119
Gene Name: IFNGR1
Gene ID: 3459
UniProt: P15260
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IFNGR1
Target Antigen: CD119
Target: PP-1127
Partner Proteins: Interferon gamma receptor 1; IFN-gamma receptor 1; IFN-gamma-R1; CDw119; Interferon gamma receptor alpha-chain; IFN-gamma-R-alpha; CD antigen CD119
Clone: K06319_11A2
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Pig - 59%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: IILPKSLISVVRSATLETKPESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 60%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Interferon gamma Receptor 1
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Interferon gamma receptor 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Interferon gamma Receptor 1 Antibody?

The catalog number for Interferon gamma Receptor 1 Antibody is KC-8862.

What sizes are available for Interferon gamma Receptor 1 Antibody?

Interferon gamma Receptor 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Interferon gamma Receptor 1 Antibody come in?

Interferon gamma Receptor 1 Antibody is available in 3 different pack sizes.

Is Interferon gamma Receptor 1 Antibody in stock?

Interferon gamma Receptor 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

All Products