Interferon gamma Receptor 1 Antibody

Catalog number KC-8863-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-8863-01

Size / count 50 μL

Specifications

Catalog number: KC-8863-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon gamma receptor 1, IFN-gamma receptor 1, IFN-gamma-R1, CDw119, Interferon gamma receptor alpha-chain, IFN-gamma-R-alpha, CD antigen CD119
Gene Name: IFNGR1
Gene ID: 3459
UniProt: P15260
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IFNGR1
Target Antigen: CD119
Target: PP-1127
Partner Proteins: Interferon gamma receptor 1; IFN-gamma receptor 1; IFN-gamma-R1; CDw119; Interferon gamma receptor alpha-chain; IFN-gamma-R-alpha; CD antigen CD119
Clone: K06319_11D1
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Pig - 59%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: IILPKSLISVVRSATLETKPESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 60%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Interferon gamma Receptor 1
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Interferon gamma receptor 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Interferon gamma Receptor 1 Antibody?

The catalog number for Interferon gamma Receptor 1 Antibody is KC-8863.

What sizes are available for Interferon gamma Receptor 1 Antibody?

Interferon gamma Receptor 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Interferon gamma Receptor 1 Antibody come in?

Interferon gamma Receptor 1 Antibody is available in 3 different pack sizes.

Is Interferon gamma Receptor 1 Antibody in stock?

Interferon gamma Receptor 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.