CD13 Antibody (Biotin)

Catalog number KB-7505-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7505-01

Size / count 50 μL

Specifications

Catalog number: KB-7505-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Aminopeptidase N, AP-N, hAPN, Alanyl aminopeptidase, Aminopeptidase M, AP-M, Microsomal aminopeptidase, Myeloid plasma membrane glycoprotein CD13, gp150, CD antigen CD13
Gene Name: ANPEP
Gene ID: 290
UniProt: P15144
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANPEP
Target Antigen: CD13
Target: PP-181
Partner Proteins: Aminopeptidase N; AP-N; hAPN; Alanyl aminopeptidase; Aminopeptidase M; AP-M; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; gp150; CD antigen CD13
Clone: K29035_20D2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 83%, Pig - 82%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: DKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: APN; CD13; PEPN
Target Alternative Name: CD13
Panel Description: IHC Pathology, CD Antigen
Host or Source: Mouse
Protein Name: Alanyl aminopeptidase, membrane, Alanyl aminopeptidase, membrane
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for CD13 Antibody (Biotin)?

The catalog number for CD13 Antibody (Biotin) is KB-7505.

What sizes are available for CD13 Antibody (Biotin)?

CD13 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD13 Antibody (Biotin) come in?

CD13 Antibody (Biotin) is available in 3 different pack sizes.

Is CD13 Antibody (Biotin) in stock?

CD13 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.