CD59 Antibody (Biotin)

Catalog number KB-27079-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-27079-01

Size / count 50 μL

Specifications

Catalog number: KB-27079-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CD59 glycoprotein, 1F5 antigen, 20 kDa homologous restriction factor, HRF-20, HRF20, MAC-inhibitory protein, MAC-IP, MEM43 antigen, Membrane attack complex inhibition factor, MACIF, Membrane inhibitor of reactive lysis, MIRL, Protectin, CD antigen CD59
Gene Name: CD59
Gene ID: 966
UniProt: P13987
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD59
Target Antigen: CD59
Target: PP-11254
Partner Proteins: CD59 glycoprotein; 1F5 antigen; 20 kDa homologous restriction factor; HRF-20; HRF20; MAC-inhibitory protein; MAC-IP; MEM43 antigen; Membrane attack complex inhibition factor; MACIF; Membrane inhibitor of reactive lysis; MIRL; Protectin; CD antigen CD59
Clone: K94067_10D1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 46%, Rat - 47%, Pig - 51%, Cynomolgus monkey - 78%
Purity: ≥85%
Cores: LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 46%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: MIC11; MIN1; MIN2; MIN3; MSK21
Target Alternative Name: CD59
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CD59 molecule (CD59 blood group)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CD59 Antibody (Biotin)?

The catalog number for CD59 Antibody (Biotin) is KB-27079.

What sizes are available for CD59 Antibody (Biotin)?

CD59 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD59 Antibody (Biotin) come in?

CD59 Antibody (Biotin) is available in 3 different pack sizes.

Is CD59 Antibody (Biotin) in stock?

CD59 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.