Recombinant HARS1 Antibody

Catalog number RC-033-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-033-01

Size / count 50 μL

Specifications

Catalog number: RC-033-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Histidine--tRNA ligase, cytoplasmic, Histidyl-tRNA synthetase, HisRS
Gene Name: HARS1
Gene ID: 3035
UniProt: P12081
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HARS1
Target: PP-166
Partner Proteins: Histidine--tRNA ligase; cytoplasmic; Histidyl-tRNA synthetase; HisRS
Clone: K70031_8G6
Conjugation: Unconjugated
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: FRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Yes
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: HARS; HRS
Target Alternative Name: HARS1
Panel Description: Autoimmune Disease
Host or Source: Human
Protein Name: Histidyl-tRNA synthetase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Recombinant HARS1 Antibody?

The catalog number for Recombinant HARS1 Antibody is RC-033.

What sizes are available for Recombinant HARS1 Antibody?

Recombinant HARS1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HARS1 Antibody come in?

Recombinant HARS1 Antibody is available in 3 different pack sizes.

Is Recombinant HARS1 Antibody in stock?

Recombinant HARS1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

All Products