Recombinant PCNA Antibody

Catalog number RC-034-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-034-01

Size / count 50 μL

Specifications

Catalog number: RC-034-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proliferating cell nuclear antigen, PCNA, Cyclin
Gene Name: PCNA
Gene ID: 5111
UniProt: P12004
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PCNA
Target: PP-4381
Partner Proteins: Proliferating cell nuclear antigen; PCNA; Cyclin
Clone: K29023_5H3
Conjugation: Unconjugated
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: PCNA
Panel Description: IHC Pathology, Autoimmune Disease, DNA binding & Chromatin
Host or Source: Human
Protein Name: Proliferating cell nuclear antigen
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Recombinant PCNA Antibody?

The catalog number for Recombinant PCNA Antibody is RC-034.

What sizes are available for Recombinant PCNA Antibody?

Recombinant PCNA Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PCNA Antibody come in?

Recombinant PCNA Antibody is available in 3 different pack sizes.

Is Recombinant PCNA Antibody in stock?

Recombinant PCNA Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.