CCL3 Antibody (Biotin)

Catalog number KB-7252-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7252-01

Size / count 50 μL

Specifications

Catalog number: KB-7252-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, Macrophage inflammatory protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible cytokine A3, Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha (4-69, LD78-alpha (4-69) ]
Gene Name: CCL3
Gene ID: 6348
UniProt: P10147
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CCL3
Target: PP-3670
Partner Proteins: C-C motif chemokine 3; G0/G1 switch regulatory protein 19-1; Macrophage inflammatory protein 1-alpha; MIP-1-alpha; PAT 464.1; SIS-beta; Small-inducible cytokine A3; Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha (4-69; LD78-alpha (4-69) ]
Clone: K24010_4B2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 76%, Rat - 77%, Pig - 79%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: TACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLEL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 76%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: G0S19-1; MIP1A; SCYA3
Target Alternative Name: CCL3
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: C-C motif chemokine ligand 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for CCL3 Antibody (Biotin)?

The catalog number for CCL3 Antibody (Biotin) is KB-7252.

What sizes are available for CCL3 Antibody (Biotin)?

CCL3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CCL3 Antibody (Biotin) come in?

CCL3 Antibody (Biotin) is available in 3 different pack sizes.

Is CCL3 Antibody (Biotin) in stock?

CCL3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

All Products