METTL15P1 Antibody (Biotin)

Catalog number KB-3729-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3729-01

Size / count 50 μL

Specifications

Catalog number: KB-3729-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative methyltransferase-like protein 15P1, Methyltransferase 5 domain-containing protein 2, Methyltransferase-like protein 15 pseudogene 1
Gene Name: METTL15P1
Gene ID: 100130758
UniProt: P0C7V9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human METTL15P1
Target: PP-9883
Partner Proteins: Putative methyltransferase-like protein 15P1; Methyltransferase 5 domain-containing protein 2; Methyltransferase-like protein 15 pseudogene 1
Clone: K1H006_15A7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Pig - 87%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: QTQVQELHRSQDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGSSLRKDGPLDIRMDGGR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: METT5D2
Target Alternative Name: METTL15P1
Host or Source: Mouse
Protein Name: Methyltransferase like 15 pseudogene 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for METTL15P1 Antibody (Biotin)?

The catalog number for METTL15P1 Antibody (Biotin) is KB-3729.

What sizes are available for METTL15P1 Antibody (Biotin)?

METTL15P1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does METTL15P1 Antibody (Biotin) come in?

METTL15P1 Antibody (Biotin) is available in 3 different pack sizes.

Is METTL15P1 Antibody (Biotin) in stock?

METTL15P1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.