Product details

Anti-MBP Tag Antibody

Catalog number KC-19258-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-19258-01

Size / count 50 μL

Specifications

Catalog number: KC-19258-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Maltose/maltodextrin-binding periplasmic protein, MMBP, Maltodextrin-binding protein, Maltose-binding protein, MBP
Gene Name: MalE
UniProt: P0AEX9
Antigen Species: Strain K12
Reactivity: Strain K12
Cross Reactivity: Not tested
Immunogen: A protein antigen containing MBP tag
Target: P02515PA
Partner Proteins: Maltose/maltodextrin-binding periplasmic protein; MMBP; Maltodextrin-binding protein; Maltose-binding protein; MBP
Clone: K11103_2H9
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Purity: ≥85%
Cores: GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: MBP Tag
Panel Description: Tag&Loading Control
Host or Source: Mouse
Protein Name: Maltose/maltodextrin-binding periplasmic protein
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Anti-MBP Tag Antibody?

The catalog number for Anti-MBP Tag Antibody is KC-19258.

What sizes are available for Anti-MBP Tag Antibody?

Anti-MBP Tag Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-MBP Tag Antibody come in?

Anti-MBP Tag Antibody is available in 3 different pack sizes.

Is Anti-MBP Tag Antibody in stock?

Anti-MBP Tag Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.