Anti-MBP Tag Antibody

Catalog number KC-19264-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-19264-01

Size / count 50 μL

Specifications

Catalog number: KC-19264-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Maltose/maltodextrin-binding periplasmic protein, MMBP, Maltodextrin-binding protein, Maltose-binding protein, MBP
Gene Name: MalE
UniProt: P0AEX9
Antigen Species: Strain K12
Reactivity: Strain K12
Cross Reactivity: Not tested
Immunogen: A protein antigen containing MBP tag
Target: P02515PA
Partner Proteins: Maltose/maltodextrin-binding periplasmic protein; MMBP; Maltodextrin-binding protein; Maltose-binding protein; MBP
Clone: K11103_3D1
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Purity: ≥85%
Cores: GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: MBP Tag
Panel Description: Tag&Loading Control
Host or Source: Mouse
Protein Name: Maltose/maltodextrin-binding periplasmic protein
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Anti-MBP Tag Antibody?

The catalog number for Anti-MBP Tag Antibody is KC-19264.

What sizes are available for Anti-MBP Tag Antibody?

Anti-MBP Tag Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-MBP Tag Antibody come in?

Anti-MBP Tag Antibody is available in 3 different pack sizes.

Is Anti-MBP Tag Antibody in stock?

Anti-MBP Tag Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.