Anti-MBP Tag Antibody

Catalog number KC-19269-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-19269-01

Size / count 50 μL

Specifications

Catalog number: KC-19269-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Maltose/maltodextrin-binding periplasmic protein, MMBP, Maltodextrin-binding protein, Maltose-binding protein, MBP
Gene Name: MalE
UniProt: P0AEX9
Antigen Species: Strain K12
Reactivity: Strain K12
Cross Reactivity: Not tested
Immunogen: A protein antigen containing MBP tag
Target: P02515PA
Partner Proteins: Maltose/maltodextrin-binding periplasmic protein; MMBP; Maltodextrin-binding protein; Maltose-binding protein; MBP
Clone: K29028_2B3
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: MBP Tag
Panel Description: Tag&Loading Control
Host or Source: Mouse
Protein Name: Maltose/maltodextrin-binding periplasmic protein
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Anti-MBP Tag Antibody?

The catalog number for Anti-MBP Tag Antibody is KC-19269.

What sizes are available for Anti-MBP Tag Antibody?

Anti-MBP Tag Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-MBP Tag Antibody come in?

Anti-MBP Tag Antibody is available in 3 different pack sizes.

Is Anti-MBP Tag Antibody in stock?

Anti-MBP Tag Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.