Product details

Anti-MBP Tag Antibody

Catalog number KC-19270-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-19270-01

Size / count 50 μL

Specifications

Catalog number: KC-19270-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Maltose/maltodextrin-binding periplasmic protein, MMBP, Maltodextrin-binding protein, Maltose-binding protein, MBP
Gene Name: MalE
UniProt: P0AEX9
Antigen Species: Strain K12
Reactivity: Strain K12
Cross Reactivity: Not tested
Immunogen: A protein antigen containing MBP tag
Target: P02515PA
Partner Proteins: Maltose/maltodextrin-binding periplasmic protein; MMBP; Maltodextrin-binding protein; Maltose-binding protein; MBP
Clone: K29028_2B4
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Purity: ≥85%
Cores: GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: MBP Tag
Panel Description: Tag&Loading Control
Host or Source: Mouse
Protein Name: Maltose/maltodextrin-binding periplasmic protein
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Anti-MBP Tag Antibody?

The catalog number for Anti-MBP Tag Antibody is KC-19270.

What sizes are available for Anti-MBP Tag Antibody?

Anti-MBP Tag Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-MBP Tag Antibody come in?

Anti-MBP Tag Antibody is available in 3 different pack sizes.

Is Anti-MBP Tag Antibody in stock?

Anti-MBP Tag Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.