G-CSF Antibody (Biotin)

Catalog number KB-7977-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7977-01

Size / count 50 μL

Specifications

Catalog number: KB-7977-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Granulocyte colony-stimulating factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim
Gene Name: CSF3
Gene ID: 1440
UniProt: P09919
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CSF3
Target: P00197PAD
Partner Proteins: Granulocyte colony-stimulating factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim
Clone: K56025_17F2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Pig - 78%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: C17orf33; GCSF
Target Alternative Name: G-CSF
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Colony stimulating factor 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for G-CSF Antibody (Biotin)?

The catalog number for G-CSF Antibody (Biotin) is KB-7977.

What sizes are available for G-CSF Antibody (Biotin)?

G-CSF Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does G-CSF Antibody (Biotin) come in?

G-CSF Antibody (Biotin) is available in 3 different pack sizes.

Is G-CSF Antibody (Biotin) in stock?

G-CSF Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

All Products