Cathepsin H Antibody

Catalog number KC-26087-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-26087-01

Size / count 50 μL

Specifications

Catalog number: KC-26087-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Pro-cathepsin H [Cleaved into: Cathepsin H mini chain, Cathepsin H, Cathepsin H heavy chain, Cathepsin H light chain]
Gene Name: CTSH
Gene ID: 1512
UniProt: P09668
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CTSH
Target: P02118PAD
Partner Proteins: Pro-cathepsin H [Cleaved into: Cathepsin H mini chain; Cathepsin H; Cathepsin H heavy chain; Cathepsin H light chain]
Clone: K94061_12E3
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 83%, Rat - 84%, Pig - 90%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: ESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 83%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CPSB
Target Alternative Name: Cathepsin H
Host or Source: Mouse
Protein Name: Cathepsin H
IHC description: Succeed
IP description: Fail (A-431)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Cathepsin H Antibody?

The catalog number for Cathepsin H Antibody is KC-26087.

What sizes are available for Cathepsin H Antibody?

Cathepsin H Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Cathepsin H Antibody come in?

Cathepsin H Antibody is available in 3 different pack sizes.

Is Cathepsin H Antibody in stock?

Cathepsin H Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.