LYN Antibody (Biotin)

Catalog number KB-2775-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-2775-01

Size / count 50 μL

Specifications

Catalog number: KB-2775-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tyrosine-protein kinase Lyn, Lck/Yes-related novel protein tyrosine kinase, V-yes-1 Yamaguchi sarcoma viral related oncogene homolog, p53Lyn, p56Lyn
Gene Name: LYN
Gene ID: 4067
UniProt: P07948
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LYN
Target: PP-1408
Partner Proteins: Tyrosine-protein kinase Lyn; Lck/Yes-related novel protein tyrosine kinase; V-yes-1 Yamaguchi sarcoma viral related oncogene homolog; p53Lyn; p56Lyn
Clone: K29043_2E1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 92%, Pig - 93%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: SLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: JTK8
Target Alternative Name: LYN
Host or Source: Mouse
Protein Name: LYN proto-oncogene, Src family tyrosine kinase, LYN proto-oncogene, Src family tyrosine kinase
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for LYN Antibody (Biotin)?

The catalog number for LYN Antibody (Biotin) is KB-2775.

What sizes are available for LYN Antibody (Biotin)?

LYN Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does LYN Antibody (Biotin) come in?

LYN Antibody (Biotin) is available in 3 different pack sizes.

Is LYN Antibody (Biotin) in stock?

LYN Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.