YES1 Antibody (Biotin)

Catalog number KB-1974-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1974-01

Size / count 50 μL

Specifications

Catalog number: KB-1974-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tyrosine-protein kinase Yes, Proto-oncogene c-Yes, p61-Yes
Gene Name: YES1
Gene ID: 7525
UniProt: P07947
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human YES1
Target: PP-1648
Partner Proteins: Tyrosine-protein kinase Yes; Proto-oncogene c-Yes; p61-Yes
Clone: K29051_1E3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 77%, Pig - 85%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: SPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: YES
Target Alternative Name: YES1
Host or Source: Mouse
Protein Name: YES proto-oncogene 1, Src family tyrosine kinase, YES proto-oncogene 1, Src family tyrosine kinase
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for YES1 Antibody (Biotin)?

The catalog number for YES1 Antibody (Biotin) is KB-1974.

What sizes are available for YES1 Antibody (Biotin)?

YES1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does YES1 Antibody (Biotin) come in?

YES1 Antibody (Biotin) is available in 3 different pack sizes.

Is YES1 Antibody (Biotin) in stock?

YES1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.