CA3 Antibody (Biotin)

Catalog number KB-8147-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8147-01

Size / count 50 μL

Specifications

Catalog number: KB-8147-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carbonic anhydrase 3, Carbonate dehydratase III, Carbonic anhydrase III, CA-III
Gene Name: CA3
Gene ID: 761
UniProt: P07451
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CA3
Target: PP-3693
Partner Proteins: Carbonic anhydrase 3; Carbonate dehydratase III; Carbonic anhydrase III; CA-III
Clone: K1E041_10E5
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 86%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: AKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CA3
Host or Source: Mouse
Protein Name: Carbonic anhydrase 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CA3 Antibody (Biotin)?

The catalog number for CA3 Antibody (Biotin) is KB-8147.

What sizes are available for CA3 Antibody (Biotin)?

CA3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CA3 Antibody (Biotin) come in?

CA3 Antibody (Biotin) is available in 3 different pack sizes.

Is CA3 Antibody (Biotin) in stock?

CA3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.