Calpain 1 Antibody

Catalog number KC-19937-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-19937-01

Size / count 50 μL

Specifications

Catalog number: KC-19937-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Calpain-1 catalytic subunit, Calcium-activated neutral proteinase 1, CANP 1, Calpain mu-type, Calpain-1 large subunit, Cell proliferation-inducing gene 30 protein, Micromolar-calpain, muCANP
Gene Name: CAPN1
Gene ID: 823
UniProt: P07384
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CAPN1
Target: PP-4293
Partner Proteins: Calpain-1 catalytic subunit; Calcium-activated neutral proteinase 1; CANP 1; Calpain mu-type; Calpain-1 large subunit; Cell proliferation-inducing gene 30 protein; Micromolar-calpain; muCANP
Clone: K16303_8E4
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 94%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: FEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSEEEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CANPL1
Target Alternative Name: Calpain 1
Host or Source: Mouse
Protein Name: Calpain 1
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Calpain 1 Antibody?

The catalog number for Calpain 1 Antibody is KC-19937.

What sizes are available for Calpain 1 Antibody?

Calpain 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Calpain 1 Antibody come in?

Calpain 1 Antibody is available in 3 different pack sizes.

Is Calpain 1 Antibody in stock?

Calpain 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

All Products