C-Jun Antibody (Biotin)

Catalog number KB-3636-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3636-01

Size / count 50 μL

Specifications

Catalog number: KB-3636-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Transcription factor Jun, Activator protein 1, AP1, Proto-oncogene c-Jun, Transcription factor AP-1 subunit Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39
Gene Name: JUN
Gene ID: 3725
UniProt: P05412
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human JUN
Target: PP-1051
Partner Proteins: Transcription factor Jun; Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39
Clone: K70016_10B3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: TVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: C-Jun
Panel Description: Neuroscience Biomarkers, Ferroptosis, Transcription Factors
Host or Source: Mouse
Protein Name: Jun proto-oncogene, AP-1 transcription factor subunit, Jun proto-oncogene, AP-1 transcription factor subunit
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for C-Jun Antibody (Biotin)?

The catalog number for C-Jun Antibody (Biotin) is KB-3636.

What sizes are available for C-Jun Antibody (Biotin)?

C-Jun Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does C-Jun Antibody (Biotin) come in?

C-Jun Antibody (Biotin) is available in 3 different pack sizes.

Is C-Jun Antibody (Biotin) in stock?

C-Jun Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

All Products