PKC-gamma Antibody

Catalog number KC-17366-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-17366-01

Size / count 50 μL

Specifications

Catalog number: KC-17366-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein kinase C gamma type, PKC-gamma
Gene Name: PRKCG
Gene ID: 5582
UniProt: P05129
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKCG
Target: PP-10663
Partner Proteins: Protein kinase C gamma type; PKC-gamma
Clone: K52063_16B5
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: LQLEIRAPTADEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PKCG
Target Alternative Name: PKC-gamma
Panel Description: Neurodegenerative Diseases Marker, Ferroptosis
Host or Source: Mouse
Protein Name: Protein kinase C gamma
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for PKC-gamma Antibody?

The catalog number for PKC-gamma Antibody is KC-17366.

What sizes are available for PKC-gamma Antibody?

PKC-gamma Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PKC-gamma Antibody come in?

PKC-gamma Antibody is available in 3 different pack sizes.

Is PKC-gamma Antibody in stock?

PKC-gamma Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

All Products