Liver Arginase Antibody (Biotin)

Catalog number KB-7852-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7852-01

Size / count 50 μL

Specifications

Catalog number: KB-7852-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Arginase-1, Liver-type arginase, Type I arginase
Gene Name: ARG1
Gene ID: 383
UniProt: P05089
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ARG1
Target: PP-088
Partner Proteins: Arginase-1; Liver-type arginase; Type I arginase
Clone: K94056_14D7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Rat - 77%, Pig - 88%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: RGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Liver Arginase
Panel Description: IHC Pathology, Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Arginase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Liver Arginase Antibody (Biotin)?

The catalog number for Liver Arginase Antibody (Biotin) is KB-7852.

What sizes are available for Liver Arginase Antibody (Biotin)?

Liver Arginase Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Liver Arginase Antibody (Biotin) come in?

Liver Arginase Antibody (Biotin) is available in 3 different pack sizes.

Is Liver Arginase Antibody (Biotin) in stock?

Liver Arginase Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

All Products