Liver Arginase Antibody (Biotin)

Catalog number KB-7853-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7853-01

Size / count 50 μL

Specifications

Catalog number: KB-7853-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Arginase-1, Liver-type arginase, Type I arginase
Gene Name: ARG1
Gene ID: 383
UniProt: P05089
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ARG1
Target: PP-088
Partner Proteins: Arginase-1; Liver-type arginase; Type I arginase
Clone: K94056_18B11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Rat - 77%, Pig - 88%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: RGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Liver Arginase
Panel Description: IHC Pathology, Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Arginase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Liver Arginase Antibody (Biotin)?

The catalog number for Liver Arginase Antibody (Biotin) is KB-7853.

What sizes are available for Liver Arginase Antibody (Biotin)?

Liver Arginase Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Liver Arginase Antibody (Biotin) come in?

Liver Arginase Antibody (Biotin) is available in 3 different pack sizes.

Is Liver Arginase Antibody (Biotin) in stock?

Liver Arginase Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

All Products