CD90 Antibody (Biotin)

Catalog number KB-27187-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-27187-01

Size / count 50 μL

Specifications

Catalog number: KB-27187-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Thy-1 membrane glycoprotein, CDw90, Thy-1 antigen, CD antigen CD90
Gene Name: THY1
Gene ID: 7070
UniProt: P04216
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human THY1
Target Antigen: CD90
Target: PP-3014
Partner Proteins: Thy-1 membrane glycoprotein; CDw90; Thy-1 antigen; CD antigen CD90
Clone: K06376_5A8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 65%, Rat - 67%, Pig - 80%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 65%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CD90
Panel Description: CD Antigen, Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Thy-1 cell surface antigen
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for CD90 Antibody (Biotin)?

The catalog number for CD90 Antibody (Biotin) is KB-27187.

What sizes are available for CD90 Antibody (Biotin)?

CD90 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD90 Antibody (Biotin) come in?

CD90 Antibody (Biotin) is available in 3 different pack sizes.

Is CD90 Antibody (Biotin) in stock?

CD90 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

All Products