IP10 Antibody (Biotin)

Catalog number KB-7874-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7874-01

Size / count 50 μL

Specifications

Catalog number: KB-7874-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, Gamma-IP10, IP-10, Small-inducible cytokine B10) [Cleaved into: CXCL10 (1-73]
Gene Name: CXCL10
Gene ID: 3627
UniProt: P02778
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CXCL10
Target: PQ-208
Partner Proteins: C-X-C motif chemokine 10; 10 kDa interferon gamma-induced protein; Gamma-IP10; IP-10; Small-inducible cytokine B10) [Cleaved into: CXCL10 (1-73]
Clone: K1E015_17F11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 70%, Rat - 73%, Pig - 88%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 70%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: INP10; SCYB10
Target Alternative Name: IP10
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: C-X-C motif chemokine ligand 10
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for IP10 Antibody (Biotin)?

The catalog number for IP10 Antibody (Biotin) is KB-7874.

What sizes are available for IP10 Antibody (Biotin)?

IP10 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IP10 Antibody (Biotin) come in?

IP10 Antibody (Biotin) is available in 3 different pack sizes.

Is IP10 Antibody (Biotin) in stock?

IP10 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.